PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01259.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 343aa    MW: 38688.2 Da    PI: 8.563
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01259.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.3e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +v+++  g+W++++++ g+ R++k+c++rw +yl
       KHN01259.1 14 KGPWTPEEDKKLVAYVEKHDHGNWHSVPAKAGLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.74.8e-17106153146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqk 46 
                      +g+WT+eEd++lv +v+++  g+W++++++     +Rt++++k++w++
       KHN01259.1 106 KGPWTPEEDKKLVAYVEKHDHGNWHSVPAKAAhlPNRTDNEIKNYWNT 153
                      79*************************98877777***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129423.684965IPR017930Myb domain
SMARTSM007176.2E-151363IPR001005SANT/Myb domain
PfamPF002495.6E-171461IPR001005SANT/Myb domain
SuperFamilySSF466898.75E-241589IPR009057Homeodomain-like
CDDcd001673.77E-121661No hitNo description
PROSITE profilePS500903.9846288IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.0E-86590IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-2297161IPR009057Homeodomain-like
SuperFamilySSF466895.53E-16100164IPR009057Homeodomain-like
PROSITE profilePS5129418.931101159IPR017930Myb domain
SMARTSM007172.1E-15105157IPR001005SANT/Myb domain
PfamPF002494.5E-15106153IPR001005SANT/Myb domain
CDDcd001671.29E-14108155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRMPCCEKV GLKKGPWTPE EDKKLVAYVE KHDHGNWHSV PAKAGLQRCG KSCRLRWINY  60
LKPDIKRGNF SMEEDRTIIQ LHALLGNNLS LKMGRMPCCE KVGLKKGPWT PEEDKKLVAY  120
VEKHDHGNWH SVPAKAAHLP NRTDNEIKNY WNTNVKKRFI RMSLDPITHK PMKSNTFEAH  180
DEFKDITNIG HVSQWESARL EAEARGSMLQ VGSGSLHLPR LILSKIPTQP CPSSNLLSTE  240
HKRVYNMYAL VLATNHDLQS SVSTLSVPKL PAVSTNIGQF TDMENLLSYN GDGNVVEISS  300
HIPKVMEGCA SNLQDDDIIM AVEAFRTPRN TSIQELFDES ASR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-17121595108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517807.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLA0A0B2P1C80.0A0A0B2P1C8_GLYSO; Transcription factor MYB28
STRINGGLYMA01G06181.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13536826
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.14e-73myb domain protein 16
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]